Product Name
Desmoglein 2 (DSG2), Monoclonal Antibody
Popular Item
Full Product Name
Mouse Anti-Desmoglein 2 [10D2]
Product Synonym Names
ARVC 10 antibody; ARVC10 antibody; ARVD 10 antibody; ARVD10 antibody; Cadherin family member 5 antibody; DHF 5 antibody; DHF5 antibody
Product Gene Name
anti-DSG2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q14126
Species Reactivity
Human. Predicted to work with: Mouse
Specificity
specifically recognizes the EC1 region of desmoglein-2
Purity/Purification
Protein A Affinity Chromatography
Form/Format
Purified antibody containing PBS + 0.1% sodium azide
Concentration
1mg/ml (lot specific)
Target Antigen
Desmoglein 2
Immunogen
N terminal amino acids 37-164 of Human Desmoglein 2 fused to a proprietary tag, Swiss ID = Q14126 LLPKHPHLVRQKRAWITAPVALREGEDLSKKNPIAKIHSD LAEERGLKITYKYTGKGITE PPFGIFVFNKDTGELNVTS ILDREETPFFLLTGYALDARGNNVEKPLELRIKVLDINDN E PVFTQDVF
Myeloma/fusion Partners
NS1 myeloma
Other Notes
Small volumes of anti-DSG2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Applications Tested/Suitable for anti-DSG2 antibody
Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunoprecipitation (IP)
Application Notes for anti-DSG2 antibody
Optimal antibody dilution should be determined by titration, however as a guideline try at WB: 1/100. Detects a band of approximately 160 kDa (predicted molecular weight: 122 kDa).
Western Blot (WB) of anti-DSG2 antibody
NCBI/Uniprot data below describe general gene information for DSG2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001934.2
[Other Products]
NCBI GenBank Nucleotide #
NM_001943.3
[Other Products]
UniProt Primary Accession #
Q14126
[Other Products]
UniProt Secondary Accession #
Q4KKU6[Other Products]
UniProt Related Accession #
Q14126[Other Products]
Molecular Weight
122,294 Da[Similar Products]
NCBI Official Full Name
desmoglein-2 preproprotein
NCBI Official Synonym Full Names
desmoglein 2
NCBI Official Symbol
DSG2 [Similar Products]
NCBI Official Synonym Symbols
HDGC; CDHF5; ARVC10; ARVD10; CMD1BB
[Similar Products]
NCBI Protein Information
desmoglein-2; HDGC; cadherin family member 5
UniProt Protein Name
Desmoglein-2
UniProt Synonym Protein Names
Cadherin family member 5; HDGC
Protein Family
Desmoglein
UniProt Gene Name
DSG2 [Similar Products]
UniProt Synonym Gene Names
CDHF5 [Similar Products]
UniProt Entry Name
DSG2_HUMAN
NCBI Summary for DSG2
Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. [provided by RefSeq, Jul 2008]
UniProt Comments for DSG2
DSG2: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Defects in DSG2 are the cause of familial arrhythmogenic right ventricular dysplasia type 10 (ARVD10); also known as arrhythmogenic right ventricular cardiomyopathy 10 (ARVC10). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall. Genetic variations in DSG2 are the cause of susceptibility to cardiomyopathy dilated type 1BB (CMD1BB). A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
Protein type: Membrane protein, integral; Cell adhesion; Calcium-binding
Chromosomal Location of Human Ortholog: 18q12.1
Cellular Component: desmosome; cell surface; apical plasma membrane; integral to membrane; plasma membrane; intercellular junction; lateral plasma membrane
Molecular Function: calcium ion binding
Biological Process: maternal process involved in pregnancy; apoptosis; homophilic cell adhesion; response to progesterone stimulus; cell adhesion; cell structure disassembly during apoptosis
Disease: Cardiomyopathy, Dilated, 1bb; Arrhythmogenic Right Ventricular Dysplasia, Familial, 10
Product References and Citations for anti-DSG2 antibody
Keim, S. et. al. Generation and characterization of monoclonal antibodies against the proregion of human desmoglein-2. Hybridoma Vol. 27 No. 4: 249-258 (2008) PUBMED
Research Articles on DSG2
1. Data demonstrate that partner desmosomal cadherins Dsg2 and Dsc2 play opposing roles in controlling colonic carcinoma cell proliferation through differential effects on EGFR signaling.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.