Product Name
DNASE1, Polyclonal Antibody
Full Product Name
DNASE1 antibody
Product Synonym Names
Polyclonal DNASE1; Anti-DNASE1; DNL1; FLJ38093; DRNI; FLJ44902; Deoxyribonuclease I; DKFZp686H0155
Product Gene Name
anti-DNASE1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P24855
Specificity
DNASE1 antibody was raised against the N terminal of DNASE1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNASE1 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.
Immunogen
DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-DNASE1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-DNASE1 antibody
Rabbit polyclonal DNASE1 antibody raised against the N terminal of DNASE1
Product Categories/Family for anti-DNASE1 antibody
DNA & RNA; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-DNASE1 antibody
Western Blot (WB)
Application Notes for anti-DNASE1 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-DNASE1 antibody
DNASE1 antibody (MBS536439) used at 1 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for DNASE1. It may not necessarily be applicable to this product.
NCBI Accession #
NP_005214
[Other Products]
NCBI GenBank Nucleotide #
NM_005223.3
[Other Products]
UniProt Primary Accession #
P24855
[Other Products]
UniProt Secondary Accession #
Q14UU9; Q14UV0; B4DV35[Other Products]
UniProt Related Accession #
P24855[Other Products]
Molecular Weight
29 kDa (MW of target protein)
NCBI Official Full Name
deoxyribonuclease-1
NCBI Official Synonym Full Names
deoxyribonuclease I
NCBI Official Symbol
DNASE1 [Similar Products]
NCBI Official Synonym Symbols
DNL1; DRNI
[Similar Products]
NCBI Protein Information
deoxyribonuclease-1
UniProt Protein Name
Deoxyribonuclease-1
UniProt Synonym Protein Names
Deoxyribonuclease I; DNase I; INN: Dornase alfa
Protein Family
Deoxyribonuclease
UniProt Gene Name
DNASE1 [Similar Products]
UniProt Synonym Gene Names
DNL1; DRNI; DNase I [Similar Products]
UniProt Entry Name
DNAS1_HUMAN
NCBI Summary for DNASE1
This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized, DNASE1*1 through DNASE1*6, and the sequence of DNASE1*2 represented in this record. Mutations in this gene have been associated with systemic lupus erythematosus (SLE), an autoimmune disease. A recombinant form of this protein is used to treat the one of the symptoms of cystic fibrosis by hydrolyzing the extracellular DNA in sputum and reducing its viscosity. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]
UniProt Comments for DNASE1
DNASE1: Among other functions, seems to be involved in cell death by apoptosis. Binds specifically to G-actin and blocks actin polymerization. Defects in DNASE1 are a cause of susceptibility to systemic lupus erythematosus (SLE). A chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Belongs to the DNase I family.
Protein type: Deoxyribonuclease; Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; EC 3.1.21.1
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: extracellular region; nuclear envelope; nucleus
Molecular Function: protein binding; deoxyribonuclease I activity; actin binding; endodeoxyribonuclease activity
Biological Process: apoptosis; DNA catabolic process, endonucleolytic
Disease: Systemic Lupus Erythematosus
Research Articles on DNASE1
1. In conclusion, elevated DNase I in diabetes may be related to pancreatic injury and could be one of the causes that induce diabetes.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.