Product Name
ATP1A3, Polyclonal Antibody
Popular Item
Full Product Name
ATP1A3 Polyclonal Antibody
Product Synonym Names
ATP1A3; AHC2; ATP1A1; CAPOS; DYT12; RDP; ATPase Na+/K+ transporting subunit alpha 3
Product Gene Name
anti-ATP1A3 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P13637
Species Reactivity
Mouse, Rat
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
0.82 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP_689509.1).
Immunogen Sequence
MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Positive Samples
Mouse Liver, Rat Liver
Cellular Location
Cell Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-ATP1A3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ATP1A3 antibody
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Applications Tested/Suitable for anti-ATP1A3 antibody
Western Blot (WB)
Application Notes for anti-ATP1A3 antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-ATP1A3 antibody
Western blot-ATP1A3 Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for ATP1A3. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001243142.1
[Other Products]
NCBI GenBank Nucleotide #
NP_001243142.1
[Other Products]
UniProt Primary Accession #
P13637
[Other Products]
UniProt Related Accession #
P13637[Other Products]
Molecular Weight
Calculated: 111kDa; 113kDa
Observed: 112kDa
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit alpha-3 isoform 2
NCBI Official Synonym Full Names
ATPase Na+/K+ transporting subunit alpha 3
NCBI Official Symbol
ATP1A3 [Similar Products]
NCBI Official Synonym Symbols
RDP; AHC2; CAPOS; DYT12; ATP1A1
[Similar Products]
NCBI Protein Information
sodium/potassium-transporting ATPase subunit alpha-3
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit alpha-3
UniProt Synonym Protein Names
Na(+)/K(+) ATPase alpha(III) subunit; Sodium pump subunit alpha-3
Protein Family
Sodium/potassium-transporting ATPase
UniProt Gene Name
ATP1A3 [Similar Products]
UniProt Synonym Gene Names
Na(+)/K(+) ATPase alpha-3 subunit [Similar Products]
UniProt Entry Name
AT1A3_HUMAN
NCBI Summary for ATP1A3
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Research Articles on ATP1A3
1. the CAPOS mutation caused a weaker voltage dependence of the pumping rate and a stronger inhibition by cytoplasmic K(+) than the WT enzyme, which together with the reduced Na(+) affinity of the cytoplasmic-facing sites precluded proper pump activation under physiological conditions.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.