Product Name
NTRK1, Polyclonal Antibody
Popular Item
Full Product Name
NTRK1 Polyclonal Antibody
Product Synonym Names
NTRK1; MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA; neurotrophic receptor tyrosine kinase 1
Product Gene Name
anti-NTRK1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P04629
Species Reactivity
Human, Mouse, Rat
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.91 mg/ml (lot specific)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human NTRK1 (NP_002520.2).
Immunogen Sequence
LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Positive Samples
Mouse Brain, Rat Brain
Cellular Location
Cell Membrane, Early Endosome Membrane, Late Endosome Membrane, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-NTRK1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-NTRK1 antibody
This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.
Applications Tested/Suitable for anti-NTRK1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes for anti-NTRK1 antibody
WB: 1:500-1:2000
IHC: 1:50-1:200
Western Blot (WB) of anti-NTRK1 antibody
Western blot-NTRK1 Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for NTRK1. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001007793.1
[Other Products]
NCBI GenBank Nucleotide #
NP_001007793.1
[Other Products]
UniProt Primary Accession #
P04629
[Other Products]
UniProt Related Accession #
P04629[Other Products]
Molecular Weight
Calculated: 77kDa; 83kDa; 86kDa; 87kDa
Observed: 140kDa
NCBI Official Full Name
high affinity nerve growth factor receptor isoform 3
NCBI Official Synonym Full Names
neurotrophic receptor tyrosine kinase 1
NCBI Official Symbol
NTRK1 [Similar Products]
NCBI Official Synonym Symbols
MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA
[Similar Products]
NCBI Protein Information
high affinity nerve growth factor receptor
UniProt Protein Name
High affinity nerve growth factor receptor
UniProt Synonym Protein Names
Neurotrophic tyrosine kinase receptor type 1; TRK1-transforming tyrosine kinase protein; Tropomyosin-related kinase A; Tyrosine kinase receptor; Tyrosine kinase receptor A; Trk-A; gp140trk; p140-TrkA
Protein Family
High affinity nerve growth factor receptor
UniProt Gene Name
NTRK1 [Similar Products]
UniProt Synonym Gene Names
MTC; TRK; TRKA; Trk-A [Similar Products]
UniProt Entry Name
NTRK1_HUMAN
NCBI Summary for NTRK1
This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008]
UniProt Comments for NTRK1
TrkA: a receptor tyrosine kinase of the Trk family. High affinity receptor for nerve growth factor, neurotrophin-3 and neurotrophin-4/5 but not brain- derived neurotrophic factor. Known substrates include Shc, PI-3K, and PLC-gamma-1. Has a crucial role in the development and function of the nociceptive reception system. Two splice variant isoforms have been described.
Protein type: Protein kinase, TK; Oncoprotein; EC 2.7.10.1; Membrane protein, integral; Protein kinase, tyrosine (receptor); Kinase, protein; TK group; Trk family
Chromosomal Location of Human Ortholog: 1q21-q22
Cellular Component: protein complex; cell surface; integral to plasma membrane; late endosome membrane; dendrite; early endosome; cell soma; early endosome membrane; axon; late endosome; plasma membrane; cytoplasmic vesicle; receptor complex; endosome
Molecular Function: neurotrophin p75 receptor binding; neurotrophin binding; protein binding; nerve growth factor receptor activity; protein homodimerization activity; ephrin receptor binding; nerve growth factor binding; transmembrane receptor protein tyrosine kinase activity; ATP binding
Biological Process: circadian rhythm; axon guidance; mechanoreceptor differentiation; peptidyl-tyrosine phosphorylation; activation of MAPKK activity; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; positive regulation of synaptic transmission, glutamatergic; protein amino acid phosphorylation; olfactory nerve development; activation of NF-kappaB transcription factor; negative regulation of cell proliferation; sympathetic nervous system development; response to radiation; learning and/or memory; small GTPase mediated signal transduction; response to axon injury; negative regulation of neuron apoptosis; response to electrical stimulus; detection of temperature stimulus involved in sensory perception of pain; response to hydrostatic pressure; aging; response to drug; response to nutrient levels; phosphoinositide-mediated signaling; adenylate cyclase activation; Sertoli cell development; detection of mechanical stimulus involved in sensory perception of pain; positive regulation of programmed cell death; positive regulation of angiogenesis; response to ethanol; phospholipase C activation; B cell differentiation; Ras protein signal transduction; response to activity; positive regulation of Ras protein signal transduction; transmembrane receptor protein tyrosine kinase signaling pathway
Disease: Thyroid Carcinoma, Familial Medullary; Insensitivity To Pain, Congenital, With Anhidrosis
Research Articles on NTRK1
1. Trk receptors Trk-A, Trk-B, and Trk-C have a propensity to interact laterally and to form dimers even in the absence of ligand.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.