Product Name
MC2 Receptor (MC2R), Polyclonal Antibody
Full Product Name
Anti-MC2 Receptor Antibody
Product Synonym Names
ACTH receptor; ACTH-R; ACTHR; MC2 receptor; MC2-R; MC2R; Q01718; Adrenocorticotropic hormone receptor; melanocortin 2 receptor
Product Gene Name
anti-MC2R antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q01718
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-MC2R antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-MC2R antibody
Rabbit IgG polyclonal antibody for Adrenocorticotropic hormone receptor(MC2R) detection.
Background: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.
Applications Tested/Suitable for anti-MC2R antibody
Western Blot (WB)
Application Notes for anti-MC2R antibody
Western Blot: 0.1-0.5ug/ml
Western Blot (WB) of anti-MC2R antibody
Western blot analysis of MC2 receptor expression in mouse brain extract (lane 1). MC2 receptor at 39KD was detected using rabbit anti- MC2 receptor Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

NCBI/Uniprot data below describe general gene information for MC2R. It may not necessarily be applicable to this product.
NCBI Accession #
NP_000520.1
[Other Products]
NCBI GenBank Nucleotide #
NM_000529.2
[Other Products]
UniProt Primary Accession #
Q01718
[Other Products]
UniProt Secondary Accession #
Q3MI45; Q504X6; A8K016[Other Products]
UniProt Related Accession #
Q01718[Other Products]
Molecular Weight
33,927 Da
NCBI Official Full Name
adrenocorticotropic hormone receptor
NCBI Official Synonym Full Names
melanocortin 2 receptor
NCBI Official Symbol
MC2R [Similar Products]
NCBI Official Synonym Symbols
ACTHR
[Similar Products]
NCBI Protein Information
adrenocorticotropic hormone receptor
UniProt Protein Name
Adrenocorticotropic hormone receptor
UniProt Synonym Protein Names
Adrenocorticotropin receptor; Melanocortin receptor 2; MC2-R
Protein Family
Adrenocorticotropic hormone receptor
UniProt Gene Name
MC2R [Similar Products]
UniProt Synonym Gene Names
ACTHR; ACTH receptor; ACTH-R; MC2-R [Similar Products]
NCBI Summary for MC2R
MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene. [provided by RefSeq, May 2014]
UniProt Comments for MC2R
MC2R: Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase. Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1); also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency. Belongs to the G-protein coupled receptor 1 family.
Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR
Chromosomal Location of Human Ortholog: 18p11.21
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: melanocortin receptor activity; protein binding
Biological Process: G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; positive regulation of cAMP biosynthetic process
Disease: Glucocorticoid Deficiency 1
Product References and Citations for anti-MC2R antibody
1. Chida, D., Nakagawa, S., Nagai, S., Sagara, H., Katsumata, H., Imaki, T., Suzuki, H., Mitani, F., Ogishima, T., Shimizu, C., Kotaki, H., Kakuta, S., Sudo, K., Koike, T., Kubo, M., Iwakura, Y. Melanocortin 2 receptor is required for adrenal gland development, steroidogenesis, and neonatal gluconeogenesis. Proc. Nat. Acad. Sci. 104: 18205-18210, 2007.
2. Naville, D., Jaillard, C., Barjhoux, L., Durand, P., Begeot, M. Genomic structure and promoter characterization of the human ACTH receptor gene. Biochem. Biophys. Res. Commun. 230: 7-12, 1997.
3. Vamvakopoulos, N. C., Rojas, K., Overhauser, J., Durkin, A. S., Nierman, W. C., Chrousos, G. P. Mapping the human melanocortin 2 receptor (adrenocorticotropic hormone receptor; ACTHR) gene (MC2R) to the small arm of chromosome 18 (18p11.21-pter). Genomics 18: 454-455, 1993.
Research Articles on MC2R
1. melanocortin receptors MC2R, MC3R and MC5R are most abundantly expressed in glandular epithelium of the endometrium
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.