Full Product Name
Anti-TREX1 Antibody
Product Synonym Names
Three-prime repair exonuclease 1; 3' 5' exonuclease TREX1; 3' repair exonuclease 1; AGS1; AGS5; CRV; Deoxyribonuclease III, dnaQ/mutD (E. coli) like; DKFZp434J0310; DNase III; DRN3; HERNS; Three prime repair exonuclease 1; TREX1; three prime repair exonuclease 1
Product Gene Name
anti-TREX1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q9NSU2
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD), different from the related mouse sequence by four amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-TREX1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-TREX1 antibody
Description: Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Background: Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.
Applications Tested/Suitable for anti-TREX1 antibody
Western Blot (WB)
Application Notes for anti-TREX1 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Western Blot (WB) of anti-TREX1 antibody
Anti-TREX1 Picoband antibody, MBS177768, Western blotting
All lanes: Anti TREX1 (MBS177768) at 0.5ug/ml
WB: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 39KD
Observed bind size: 33KD

NCBI/Uniprot data below describe general gene information for TREX1. It may not necessarily be applicable to this product.
NCBI Accession #
NP_009179.2
[Other Products]
NCBI GenBank Nucleotide #
NM_007248.3
[Other Products]
UniProt Primary Accession #
Q9NSU2
[Other Products]
UniProt Secondary Accession #
Q8TEU2; Q9BPW1; Q9Y4X2; B2RCN9[Other Products]
UniProt Related Accession #
Q9NSU2[Other Products]
Molecular Weight
33,212 Da
NCBI Official Full Name
three-prime repair exonuclease 1 isoform c
NCBI Official Synonym Full Names
three prime repair exonuclease 1
NCBI Official Symbol
TREX1 [Similar Products]
NCBI Official Synonym Symbols
CRV; AGS1; DRN3; HERNS
[Similar Products]
NCBI Protein Information
three-prime repair exonuclease 1
UniProt Protein Name
Three-prime repair exonuclease 1
UniProt Synonym Protein Names
3'-5' exonuclease TREX1; DNase III
Protein Family
Three-prime repair exonuclease
UniProt Gene Name
TREX1 [Similar Products]
UniProt Entry Name
TREX1_HUMAN
NCBI Summary for TREX1
This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]
UniProt Comments for TREX1
TREX1: the major 3' DNA exonuclease in mammalian cells. Normally associates with the endoplasmic reticulum (ER). Translocates to the nucleus at S phase after DNA damage by gamma-irradiation or hydroxyurea. Trex1-deficient cells show defective G1/S transition, with single-stranded DNA molecules persisting after S phase and accumulating in the ER. Degrades ssDNA. Prevents chronic checkpoint activation and inappropriate immune activation. Mutations cause Aicardi-Goutieres syndrome, an autoimmune disorder. Trex1a(-/-) mice have autoinflammatory responses. The gene for this protein is either identical to or adjacent to that of ATRIP. Some of the mRNAs that encode TREX1 also encode ATRIP in another reading frame. Three alternatively spliced human isoforms have been reported.
Protein type: EC 3.1.11.2; Deoxyribonuclease; DNA-binding; DNA repair, damage; Cell cycle regulation
Chromosomal Location of Human Ortholog: 3p21.31
Cellular Component: cytosol; endoplasmic reticulum membrane; nuclear envelope
Molecular Function: 3'-5' exonuclease activity; 3'-5'-exodeoxyribonuclease activity; exodeoxyribonuclease III activity; metal ion binding; MutLalpha complex binding; MutSalpha complex binding; protein binding; protein homodimerization activity; single-stranded DNA binding
Biological Process: DNA metabolic process; DNA recombination; DNA repair; DNA replication; mismatch repair; regulation of interferon type I production
Disease: Aicardi-goutieres Syndrome 1; Chilblain Lupus 1; Systemic Lupus Erythematosus; Vasculopathy, Retinal, With Cerebral Leukodystrophy
Product References and Citations for anti-TREX1 antibody
1. "Entrez Gene: TREX1 three prime repair exonuclease 1". 2. Mazur DJ, Perrino FW (Aug 1999). "Identification and expression of the TREX1 and TREX2 cDNA sequences encoding mammalian 3'-->5' exonucleases". J Biol Chem 274 (28): 19655-60.
Research Articles on TREX1
1. Aicardi-Goutieres syndrome 1 is caused by mutations in the three prime repair exonuclease 1 gene (TREX1, MIM 606609).
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.