Product Name
KChIP2, Polyclonal Antibody
Full Product Name
Anti-KChIP2 Antibody
Product Synonym Names
Kv channel-interacting protein 2; A type potassium channel modulatory protein 2; A-type potassium channel modulatory protein 2; Cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP 2; KChIP2; KCIP2_HUMAN; KCNIP 2; Kcnip2; Kv channel interacting protein 2; Kv channel-interacting protein 2; MGC17241; Potassium channel interacting protein 2; Potassium channel-interacting protein 2; Kv channel interacting protein 2
Product Gene Name
anti-KChIP2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q9NS61
Species Reactivity
Human, Mouse, Rat
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-KChIP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-KChIP2 antibody
Description: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
Applications Tested/Suitable for anti-KChIP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-KChIP2 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Western Blot (WB) of anti-KChIP2 antibody
Anti- KCNIP2 Picoband antibody, MBS177876, Western blotting
All lanes: Anti KCNIP2 (MBS177876) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD

Immunohistochemistry (IHC) of anti-KChIP2 antibody
Anti- KCNIP2 Picoband antibody, MBS177876,IHC(P)
IHC(P): Mouse Brain Tissue

Immunohistochemistry (IHC) of anti-KChIP2 antibody
Anti- KCNIP2 Picoband antibody, MBS177876,IHC(P)
IHC(P): Human Glioma Tissue

Immunohistochemistry (IHC) of anti-KChIP2 antibody
Anti- KCNIP2 Picoband antibody, MBS177876,IHC(P)
IHC(P): Rat Brain Tissue

NCBI/Uniprot data below describe general gene information for KChIP2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_055406.2
[Other Products]
NCBI GenBank Nucleotide #
NM_014591.4
[Other Products]
UniProt Primary Accession #
Q9NS61
[Other Products]
UniProt Secondary Accession #
Q3YAC6; Q3YAC8; Q3YAC9; Q7Z6F1; Q96K86; Q96T41; Q96T42; Q96T43; Q96T44; A6NJE5; A8MQ75[Other Products]
UniProt Related Accession #
Q9NS61[Other Products]
Molecular Weight
21,401 Da
NCBI Official Full Name
Kv channel-interacting protein 2 isoform 1
NCBI Official Synonym Full Names
potassium voltage-gated channel interacting protein 2
NCBI Official Symbol
KCNIP2 [Similar Products]
NCBI Official Synonym Symbols
KCHIP2
[Similar Products]
NCBI Protein Information
Kv channel-interacting protein 2
UniProt Protein Name
Kv channel-interacting protein 2
UniProt Synonym Protein Names
A-type potassium channel modulatory protein 2; Cardiac voltage-gated potassium channel modulatory subunit; Potassium channel-interacting protein 2
UniProt Gene Name
KCNIP2 [Similar Products]
UniProt Synonym Gene Names
KCHIP2; KChIP2 [Similar Products]
UniProt Entry Name
KCIP2_HUMAN
NCBI Summary for KChIP2
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008]
UniProt Comments for KChIP2
KCNIP2: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. Belongs to the recoverin family. 9 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 10q24
Cellular Component: cytoplasm; plasma membrane; voltage-gated potassium channel complex
Molecular Function: A-type (transient outward) potassium channel activity; calcium ion binding; ER retention sequence binding; identical protein binding; potassium channel regulator activity; protein binding; protein N-terminus binding
Biological Process: clustering of voltage-gated potassium channels; detection of calcium ion; muscle contraction; potassium ion transport; regulation of heart contraction; signal transduction; synaptic transmission
Product References and Citations for anti-KChIP2 antibody
1. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ (Feb 2000). "Modulation of A-type potassium channels by a family of calcium sensors". Nature 403(6769): 553-6. 2. Burgoyne RD (2007). "Neuronal calcium sensor proteins: generating diversity in neuronal Ca2+ signalling". Nat. Rev. Neurosci. 8 (3): 182-93.
Research Articles on KChIP2
1. A novel KCNQ1-G229D mutation identified in a juvenile-onset AF patient altered the IKs activity and kinetics, thereby increasing the arrhythmogenicity to AF.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.