Full Product Name
Anti-SCN4B Antibody
Product Synonym Names
Sodium channel subunit beta-4; SCN4B; Sodium voltage-gated channel beta subunit 4
Product Gene Name
anti-SCN4B antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q8IWT1
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Immunogen
A synthetic peptide corresponding to a sequence of human SCN4B (LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500mug/ml.
Relevant Detection Systems
We recommend Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P).
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, store at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-SCN4B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SCN4B antibody
Description: Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Background: Sodium channel beta-subunit 4, also known as SCN4B or Nabeta4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.
Applications Tested/Suitable for anti-SCN4B antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-SCN4B antibody
WB: 0.1-0.5ug/ml
IHC-P: 0.5-1ug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested.
NCBI/Uniprot data below describe general gene information for SCN4B. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001135820.1
[Other Products]
NCBI GenBank Nucleotide #
NM_001142348.1
[Other Products]
UniProt Primary Accession #
Q8IWT1
[Other Products]
UniProt Secondary Accession #
Q6PIG5; E9PPT5[Other Products]
UniProt Related Accession #
Q8IWT1[Other Products]
Molecular Weight
13,104 Da
NCBI Official Full Name
sodium channel subunit beta-4 isoform 2
NCBI Official Synonym Full Names
sodium voltage-gated channel beta subunit 4
NCBI Official Symbol
SCN4B [Similar Products]
NCBI Official Synonym Symbols
LQT10; ATFB17; Navbeta4
[Similar Products]
NCBI Protein Information
sodium channel subunit beta-4
UniProt Protein Name
Sodium channel subunit beta-4
Protein Family
Sodium channel
UniProt Gene Name
SCN4B [Similar Products]
NCBI Summary for SCN4B
The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.[provided by RefSeq, Mar 2009]
UniProt Comments for SCN4B
Modulates channel gating kinetics. Causes negative shifts in the voltage dependence of activation of certain alpha sodium channels, but does not affect the voltage dependence of inactivation. Modulates the susceptibility of the sodium channel to inhibition by toxic peptides from spider, scorpion, wasp and sea anemone venom.
Product References and Citations for anti-SCN4B antibody
1. Li, R.-G., Wang, Q., Xu, Y.-J., Zhang, M., Qu, X.-K., Liu, X., Fang, W.-Y., Yang, Y.-Q. Mutations of the SCN4B-encoded sodium channel beta-4 subunit in familial atrial fibrillation. Int. J. Molec. Med. 32: 144-150, 2013. 2. Medeiros-Domingo, A., Kaku, T., Tester, D. J., Iturralde-Torres, P., Itty, A., Ye, B., Valdivia, C., Ueda, K., Canizales-Quinteros, S., Tusie-Luna, M. T., Makielski, J. C., Ackerman, M. J. SCN4B-encoded sodium channel beta-4 subunit in congenital long-QT syndrome. Circulation 116: 134-142, 2007.
Research Articles on SCN4B
1. SCN4B overexpression reduces cancer cell invasiveness and tumour progression.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.