Full Product Name
RDH12 antibody
Product Synonym Names
Polyclonal RDH12; Anti-RDH12; Retinol Dehydrogenase 12; All-Trans/9-Cis/11-Cis; RDH-12; RDH12; FLJ30273; RDH 12; LCA3
Product Gene Name
anti-RDH12 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDH12 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).
Immunogen
RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-RDH12 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-RDH12 antibody
Rabbit polyclonal RDH12 antibody
Product Categories/Family for anti-RDH12 antibody
Nutrition & Metabolism; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-RDH12 antibody
Western Blot (WB)
Application Notes for anti-RDH12 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-RDH12 antibody
RDH12 antibody (MBS5301566) used at 1 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for RDH12. It may not necessarily be applicable to this product.
NCBI Accession #
NP_689656.2
[Other Products]
NCBI GenBank Nucleotide #
NM_152443.2
[Other Products]
UniProt Secondary Accession #
Q8TAW6; B2RDA2[Other Products]
UniProt Related Accession #
Q96NR8[Other Products]
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
retinol dehydrogenase 12
NCBI Official Synonym Full Names
retinol dehydrogenase 12 (all-trans/9-cis/11-cis)
NCBI Official Symbol
RDH12 [Similar Products]
NCBI Official Synonym Symbols
LCA3; RP53; LCA13; SDR7C2
[Similar Products]
NCBI Protein Information
retinol dehydrogenase 12
UniProt Protein Name
Retinol dehydrogenase 12
UniProt Synonym Protein Names
All-trans and 9-cis retinol dehydrogenase; Short chain dehydrogenase/reductase family 7C member 2
Protein Family
Retinol dehydrogenase
UniProt Gene Name
RDH12 [Similar Products]
UniProt Synonym Gene Names
SDR7C2 [Similar Products]
UniProt Entry Name
RDH12_HUMAN
NCBI Summary for RDH12
The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). [provided by RefSeq, Jul 2008]
UniProt Comments for RDH12
RDH12: Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Might be the key enzyme in the formation of 11-cis-retinal from 11-cis-retinol during regeneration of the cone visual pigments. Defects in RDH12 are the cause of Leber congenital amaurosis type 13 (LCA13). LCA designates a clinically and genetically heterogeneous group of childhood retinal degenerations, generally inherited in an autosomal recessive manner. Affected infants have little or no retinal photoreceptor function as tested by electroretinography. LCA represents the most common genetic cause of congenital visual impairment in infants and children. Defects in RDH12 are the cause of retinitis pigmentosa type 53 (RP53). RP53 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Protein type: EC 1.1.1.-; Cofactor and Vitamin Metabolism - retinol; Oxidoreductase
Chromosomal Location of Human Ortholog: 14q24.1
Cellular Component: intracellular
Molecular Function: protein binding; retinol dehydrogenase activity
Biological Process: phototransduction, visible light; visual perception; retinol metabolic process; photoreceptor cell maintenance; retinoid metabolic process
Disease: Leber Congenital Amaurosis 13
Research Articles on RDH12
1. Mutations in the AIPL1 and RDH12 genes associated with leber congenital amaurosis in two Turkish families.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.