Product Name
SLC36A2, Polyclonal Antibody
Full Product Name
SLC36A2 antibody
Product Synonym Names
Polyclonal SLC36A2; Anti-SLC36A2; Solute Carrier Family 36 Member 2; SLCA2-36; PAT2; MGC119660; TRAMD1; FLJ16051; Proton/Amino Acid Symporter 2; MGC119658; SLCA2 36; SLC36A2
Product Gene Name
anti-SLC36A2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC36A2 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.
Immunogen
SLC36A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SLC36A2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SLC36A2 antibody
Rabbit polyclonal SLC36A2 antibody
Product Categories/Family for anti-SLC36A2 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-SLC36A2 antibody
Western Blot (WB)
Application Notes for anti-SLC36A2 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-SLC36A2 antibody
Recommended SLC36A2 Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry (IHC) of anti-SLC36A2 antibody
Skeletal muscle

NCBI/Uniprot data below describe general gene information for SLC36A2. It may not necessarily be applicable to this product.
NCBI Accession #
AAI01103.1
[Other Products]
UniProt Secondary Accession #
Q495M4; Q495M6; Q6ZWK5; Q7Z6B5[Other Products]
UniProt Related Accession #
Q495M3[Other Products]
Molecular Weight
53 kDa (MW of target protein)
NCBI Official Full Name
SLC36A2 protein
NCBI Official Synonym Full Names
solute carrier family 36 (proton/amino acid symporter), member 2
NCBI Official Symbol
SLC36A2 [Similar Products]
NCBI Official Synonym Symbols
PAT2; TRAMD1
[Similar Products]
NCBI Protein Information
proton-coupled amino acid transporter 2
UniProt Protein Name
Proton-coupled amino acid transporter 2
UniProt Synonym Protein Names
Solute carrier family 36 member 2; Tramdorin-1
Protein Family
Proton-coupled amino acid transporter
UniProt Gene Name
SLC36A2 [Similar Products]
UniProt Synonym Gene Names
PAT2; TRAMD1; Proton/amino acid transporter 2 [Similar Products]
UniProt Entry Name
S36A2_HUMAN
NCBI Summary for SLC36A2
This gene encodes a pH-dependent proton-coupled amino acid transporter that belongs to the amino acid auxin permease 1 protein family. The encoded protein primarily transports small amino acids such as glycine, alanine and proline. Mutations in this gene are associated with iminoglycinuria and hyperglycinuria. [provided by RefSeq, Sep 2010]
UniProt Comments for SLC36A2
SLC36A2: Involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids. Transports glycine and proline. Inhibited by sarcosine. Defects in SLC36A2 are a cause of hyperglycinuria (HG). It is a condition characterized by excess of glycine in the urine. In some cases it is associated with renal colic and renal oxalate stones. Defects in SLC36A2 are a cause of iminoglycinuria (IG). It is a disorder of renal tubular reabsorption of glycine and imino acids (proline and hydroxyproline), marked by excessive levels of all three substances in the urine. Mutations in SLC36A2 that retain residual transport activity result in the IG phenotype only when combined with haploinsufficiency of the imino acid transporter SLC6A20 or deficiency of the neutral amino acid transporter SLC6A19. Additional polymorphisms and mutations in SLC6A18 can contribute to iminoglycinuria in some families. Belongs to the amino acid/polyamine transporter 2 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q33.1
Cellular Component: vacuolar membrane; plasma membrane; integral to membrane
Molecular Function: glycine transmembrane transporter activity; L-proline transmembrane transporter activity; hydrogen:amino acid symporter activity; hydrogen ion transmembrane transporter activity; L-alanine transmembrane transporter activity
Biological Process: glycine transport; proton transport; amino acid transport; ion transport; transmembrane transport; L-alanine transport
Disease: Iminoglycinuria; Hyperglycinuria
Research Articles on SLC36A2
1. Observational study of gene-disease association. (HuGE Navigator)
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.