Full Product Name
SC5DL antibody
Product Synonym Names
Polyclonal SC5DL; Anti-SC5DL; SC5DL; SCDL-5; S5DES; Erg3 Delta-5-Desaturase Homolog S. Cerevisiae-Like; SCDL 5; Sterol-C5-Desaturase; SC5D; ERG3
Product Gene Name
anti-SC5DL antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SC5DL antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
Immunogen
SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SC5DL antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SC5DL antibody
Rabbit polyclonal SC5DL antibody
Product Categories/Family for anti-SC5DL antibody
Hormones & Steroids; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-SC5DL antibody
Western Blot (WB)
Application Notes for anti-SC5DL antibody
WB: 1 ug/ml
NCBI/Uniprot data below describe general gene information for SC5DL. It may not necessarily be applicable to this product.
NCBI Accession #
EAW67522.1
[Other Products]
UniProt Secondary Accession #
O00119; Q6GTM5; Q9UK15[Other Products]
UniProt Related Accession #
O75845[Other Products]
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like, isoform CRA_b
NCBI Official Synonym Full Names
sterol-C5-desaturase
NCBI Official Symbol
SC5D [Similar Products]
NCBI Official Synonym Symbols
ERG3; S5DES; SC5DL
[Similar Products]
NCBI Protein Information
lathosterol oxidase
UniProt Protein Name
Lathosterol oxidase
UniProt Synonym Protein Names
C-5 sterol desaturase; Delta(7)-sterol 5-desaturase; Lathosterol 5-desaturase; Sterol-C5-desaturase
UniProt Gene Name
SC5D [Similar Products]
UniProt Synonym Gene Names
SC5DL [Similar Products]
UniProt Entry Name
SC5D_HUMAN
NCBI Summary for SC5DL
This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
UniProt Comments for SC5DL
SC5DL: Catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol. Defects in SC5DL are the cause of lathosterolosis (LATHST). This autosomal recessive disorder is characterized by a complex phenotype, including multiple congenital anomalies, mental retardation, and liver disease. Belongs to the sterol desaturase family.
Protein type: Oxidoreductase; Membrane protein, integral; Lipid Metabolism - steroid biosynthesis; EC 1.14.21.6; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 11q23.3
Cellular Component: endoplasmic reticulum membrane; integral to membrane
Molecular Function: C-5 sterol desaturase activity; lathosterol oxidase activity; iron ion binding
Biological Process: cholesterol biosynthetic process via lathosterol; lipid metabolic process; cholesterol biosynthetic process; fatty acid biosynthetic process
Disease: Lathosterolosis
Research Articles on SC5DL
1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
