Product Name
Claudin 16 (CLDN16), Polyclonal Antibody
Full Product Name
Claudin 16 antibody
Product Synonym Names
Polyclonal Claudin 16; Anti-Claudin 16; Claudin 16; Claudin -16; HOMG3; CLDN16; PCLN1
Product Gene Name
anti-CLDN16 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Specificity
Claudin 16 antibody was raised against the C terminal of CLDN16
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLDN16 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
Immunogen
Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-CLDN16 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CLDN16 antibody
Rabbit polyclonal Claudin 16 antibody raised against the C terminal of CLDN16
Product Categories/Family for anti-CLDN16 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-CLDN16 antibody
Western Blot (WB)
Application Notes for anti-CLDN16 antibody
WB: 0.5 ug/ml
Western Blot (WB) of anti-CLDN16 antibody
Claudin 16 antibody (MBS5300432) used at 0.5 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for CLDN16. It may not necessarily be applicable to this product.
NCBI Accession #
NP_006571.1
[Other Products]
NCBI GenBank Nucleotide #
NM_006580.3
[Other Products]
UniProt Related Accession #
Q9Y5I7[Other Products]
Molecular Weight
34 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
claudin-16
NCBI Official Synonym Full Names
claudin 16
NCBI Official Symbol
CLDN16 [Similar Products]
NCBI Official Synonym Symbols
HOMG3; PCLN1
[Similar Products]
NCBI Protein Information
claudin-16
UniProt Protein Name
Claudin-16
UniProt Synonym Protein Names
Paracellin-1; PCLN-1
UniProt Gene Name
CLDN16 [Similar Products]
UniProt Synonym Gene Names
PCLN1; PCLN-1 [Similar Products]
UniProt Entry Name
CLD16_HUMAN
NCBI Summary for CLDN16
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. This gene and the CLDN1 gene are clustered on chromosome 3q28. [provided by RefSeq, Jun 2010]
UniProt Comments for CLDN16
Claudin-16: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form, alone or in partnership with other constituents, an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively, it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors. Defects in CLDN16 are the cause of hypomagnesemia type 3 (HOMG3); also known as familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC). HOMG3 is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis. Recurrent urinary tract infections and kidney stones are often observed. In spite of hypercalciuria, patients do not show hypocalcemia. Belongs to the claudin family.
Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3q28
Cellular Component: tight junction; plasma membrane; integral to membrane
Molecular Function: identical protein binding; protein binding; magnesium ion transmembrane transporter activity; structural molecule activity
Biological Process: cellular metal ion homeostasis; excretion; calcium-independent cell-cell adhesion; magnesium ion transport
Disease: Hypomagnesemia 3, Renal
Research Articles on CLDN16
1. A novel CLDN16 mutation has been identified in a large consanguineous family with familial hypomagnesaemia with hypercalciuria and nephrocalcinosis.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.