Catalogue number
CYT-039
Synonyms
Osteogenic Protein 1, BMP-7.
Introduction
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Description
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
The BMP-7 is purified by proprietary chromatographic techniques.
Source
Nicotiana benthamiana.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Solubility
Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.
Stability
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity
Greater than 97.0% as determined by SDS-PAGE.
Amino acid sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN
SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY
YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP
CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Biological Activity
The
biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED
50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Safety Data Sheet
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.